Electronic Commerce  

New York E-Commerce Providers

 
   

USA Regional Directory > Electronic Commerce > New York

Submit a Website
 
a conceptual e-commerce illustration - with New York icon
This web page lists e-commerce service providers in the State of New York.  Before visiting any of these New York e-commerce service providers, be sure to verify their address, hours of operation, and appointment requirements (if any).  An e-commerce service may have ceased operations or moved to a different address, and business hours can sometimes vary, especially on and around holidays.  So a quick phone call can often save you time and aggravation.

Related directory pages are highlighted below the New York e-commerce service listings on this page.  Links to E-Commerce directory pages for adjacent States are provided at the bottom of the page.  New York directory and map page links are also included there.


Advertise Your New York E-Commerce Web Site Here!

1800 Printing Inc
New York, New York 10016
1-212-945-8711
www.1800printingny.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Print Brokers
  • Printing Consultants

540 Park Restaurant
New York, New York 10065
1-212-826-5674
www.loewshotels.com/en/Regency-Hotel/dining/restaurants
Located in New York County
  • American Restaurants
  • Electronic Commerce
  • Restaurants

A J Foreign Auto
Ithaca, New York 14850
1-607-272-1324
ajforeignauto.com/
Located in Tompkins County
  • Auto Inspection
  • Auto Service and Repair
  • Electronic Commerce

A Votre Service Events LLC
New York, New York 10014
1-800-757-0549
avsevent.com
Located in New York County
  • Banquet Facilities
  • Electronic Commerce
  • Event Planning
  • Party Planning
  • Wedding Planners

Accentuating Service
New York, New York 10065
1-212-688-6506
www.accentuatingservice.com
Located in New York County
  • Adult and Continuing Education
  • Business and Personal Coaching
  • Electronic Commerce

Advertising Age
New York, New York 10017
1-212-210-0200
www.adage.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

Albany Fashions
Albany, New York 12211
1-518-271-7488
www.albanyfashions.com
Located in Albany County
  • Clothing Stores
  • Electronic Commerce

Albany Print Inc
Albany, New York 12206
1-518-633-1458
www.albanyprint.com
Located in Albany County
  • Commercial Printing
  • Copying and Duplicating Services
  • Electronic Commerce
  • Printing Services

Always Ready Locksmith
New York, New York 10023
1-212-873-2238
alwaysreadylocksmith.com
Located in New York County
  • Electronic Commerce

American Handicap Defense Fund
Binghamton, New York 13901
1-607-724-3596
disablelaw.org
Located in Broome County
  • Electronic Commerce

American Mailbox
Niagara Falls, New York 14303
1-716-236-7299
www.americanmailbox.net
Located in Niagara County
  • Custom Auto Painting
  • Electronic Commerce
  • Mailboxes Retail

Ancare Corporation
Bellmore, New York 11710
1-516-781-4937
ancare.com
Located in Nassau County
  • Electronic Commerce

Antiquarian Booksellers Association
New York, New York 10036
1-212-944-8293
www.abaa.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Professional and Trade Associations
  • Residential Care Facilities

Arabic Virtual Translation Center
New York, New York 10016
1-212-697-0513
www.avtcllc.com
Located in New York County
  • Electronic Commerce
  • Language Schools and Instruction
  • Translators and Interpreters

Arcade Classics
New York, New York 10001
1-212-361-9103
www.arcadeclassics.net
Located in New York County
  • Arcade Games and Machines
  • Electronic Commerce
  • Video Games

Armenian Educational
Congers, New York 10920
1-845-268-2069
armenianmedicalfund.com
Located in Rockland County
  • Business Education
  • Electronic Commerce

Arrow Express
New York, New York 10013
1-212-714-1986
www.arrowexpress.com
Located in New York County
  • Electronic Commerce
  • Freight Forwarding

Art Guard LLC
New York, New York 10011
1-212-989-1594
artguard.net
Located in New York County
  • Art Supplies Retail
  • Electronic Commerce

ARZA
New York, New York 10017
1-212-650-4280
arza.org
Located in New York County
  • Electronic Commerce

Atm Supply
Buffalo, New York 14207
1-716-855-3417
atmsupplyco.com
Located in Erie County
  • Electronic Commerce
  • Fasteners

Av Source
New York, New York 10016
1-212-689-4016
www.avsourceny.com
Located in New York County
  • Electronic Commerce

Ba Cleaning Service Etc
New York, New York 10030
1-212-234-9807
www.nyfullservicecleaning.com
Located in New York County
  • Cleaning Services
  • Electronic Commerce
  • Housecleaning
  • Maids and Butlers
  • Office Building and Industrial Cleaning Services

Babesta
New York, New York 10007
1-212-504-8107
babesta.com
Located in New York County
  • Electronic Commerce

Bank Leumi Leasing Corporation
New York, New York 10036
1-212-626-1271
leumiusa.com
Located in New York County
  • Banks
  • Commercial and Industrial Rental and Leasing
  • Electronic Commerce
  • Tool Rental and Leasing

Bare Body Collection LLC
New York, New York 10028
1-917-703-3535
barebodycollection.com
Located in New York County
  • Electronic Commerce

Bateaux
New York, New York 10011
1-212-352-9009
bateauxnewyork.com
Located in New York County
  • Electronic Commerce

Benchmark Computer Solutions
Syosset, New York 11791
1-516-921-0095
www.benchmarkcs.com
Located in Nassau County
  • Business Services
  • Computer Consultants
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Network Solutions

Beretta Gallery
New York, New York 10065
1-212-319-3235
www.berettausa.com
Located in New York County
  • Electronic Commerce

Bible Literacy Project
New York, New York 10029
1-212-348-8634
bibleliteracy.org
Located in New York County
  • Church and Religious Associations and Organizations
  • Churches
  • Electronic Commerce

Big City Sportswear & Graphics
Rochester, New York 14624
1-585-594-1118
www.bigcitysportswear.com
Located in Monroe County
  • Electronic Commerce
  • Embroidery Service
  • Screen Printing
  • T-Shirts Retail

Bike World Usa
Schenectady, New York 12302
1-518-831-1751
bikeworldusa.com
Located in Schenectady County
  • Electronic Commerce

Biovericom
Troy, New York 12180
1-518-273-1090
www.biovericom.com
Located in Rensselaer County
  • Community and Civic Organizations
  • Electronic Commerce

Bizpup Website Provders
Buffalo, New York 14214
1-716-836-3457
www.bizpup.com/contact
Located in Erie County
  • Electronic Commerce
  • Information Technology Services
  • Internet Advertising
  • Internet Domain Registration and Brokering
  • Internet Products and Services
  • Internet Services
  • Web Sites

Blitman & King
Latham, New York 12110
1-518-785-4387
www.bklawyers.com/
Located in Albany County
  • Electronic Commerce

Blue And Cream LLC
East Hampton, New York 11937
1-631-329-1392
www.blueandcream.com
Located in Suffolk County
  • Clothing Stores
  • Electronic Commerce

Blue Ice Clothing
Pine Hill, New York 12465
1-845-254-4704
blueiceclothing.com
Located in Ulster County
  • Clothing Stores
  • Electronic Commerce

Bond No 9
New York, New York 10021
1-212-794-4480
bondno9.com
Located in New York County
  • Electronic Commerce
  • Perfumes and Colognes Retail

Book Smart Studio
Rochester, New York 14607
1-585-730-8320
booksmartstudio.com
Located in Monroe County
  • Commercial Printing
  • Copying and Duplicating Services
  • Electronic Commerce
  • Photofinishing Retail

Bounkit Design
New York, New York 10001
1-212-244-1877
www.bounkit.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Brighton-Eggert Animal Clinic - Julia I Miska DVM
Tonawanda, New York 14150
1-716-833-4266
www.brightoneggert.com
Located in Erie County
  • Electronic Commerce
  • Veterinarians

British Tools & Fasteners LLC
Lyons, New York 14489
1-315-946-9400
britishfasteners.com
Located in Wayne County
  • Antique and Classic Auto Parts
  • Antiques
  • Electronic Commerce

Broome Obstetrics & Gynecology - Kathleen B Buglione MD
Binghamton, New York 13905
1-607-770-7074
broomeobgyn.com
Located in Broome County
  • Electronic Commerce
  • General Practice
  • Midwives
  • Nurse Practitioners

Broome Obstetrics & Gynecology - Michael A Farrell MD
Binghamton, New York 13905
1-607-770-7074
www.broomeobgyn.com/
Located in Broome County
  • Electronic Commerce

Buffalo Hotel Supply
Guilderland, New York 12084
1-888-838-8020
buffalohotelsupply.com
Located in Albany County
  • Electronic Commerce

Buffalo Water Filtration Plant
Buffalo, New York 14201
1-716-851-4731
ci.buffalo.ny.us
Located in Erie County
  • Electronic Commerce
  • Water and Sewage Companies

C Gerard Marketing
Amsterdam, New York 12010
1-800-219-4299
cgerardmarketing.com
Located in Montgomery County
  • Advertising Specialties Wholesale and Manufacturers
  • Electronic Commerce

Cambridge Corporate Service
New York, New York 10004
1-212-425-2882
cambridgeservices.com
Located in New York County
  • Business Brokers
  • Electronic Commerce

Camp Che Na Wah
Minerva, New York 12851
1-518-251-3129
campbaco.com
Located in Essex County
  • Camps
  • Electronic Commerce
  • Sports Camps

Cegid Corporation
New York, New York 10016
1-212-757-9051
cegid.com
Located in New York County
  • Computer Software
  • Electronic Commerce

Center For Book Arts Inc
New York, New York 10001
1-212-481-9853
www.centerforbookarts.com
Located in New York County
  • Bookbinding
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Government Contractors

Centro Altagracia
New York, New York 10032
1-212-568-2118
centroaltagracia.org
Located in New York County
  • Catholic Churches
  • Church and Religious Associations and Organizations
  • Churches
  • Electronic Commerce

Childrens Environmental
Chappaqua, New York 10514
1-914-238-4743
celfeducation.org
Located in Westchester County
  • Electronic Commerce
  • Government Contractors
  • Social Workers

Christ Church United Methodist
Troy, New York 12180
1-518-273-8042
www.christchurchtroy.org
Located in Rensselaer County
  • Churches
  • Electronic Commerce
  • Methodist Churches

Citixsys Technologies
New York, New York 10020
1-212-745-1365
www.citixsys.com
Located in New York County
  • Computer Software
  • Electronic Commerce

City Blossoms Inc
New York, New York 10006
1-212-269-8190
cityblossoms.com
Located in New York County
  • Electronic Commerce

Cmple.com Inc
Brooklyn, New York 11230
1-347-587-6480
cmple.com
Located in Kings County
  • Computer Printers
  • Consumer Electronics Stores
  • Electronic Commerce
  • Electronic Equipment and Supplies Wholesale and Manufacturers

Communist Party Us National Ofc
New York, New York 10011
1-212-229-1713
www.cpusa.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Community Place Of Greater
Rochester, New York 14609
1-585-288-8662
www.communityplace.org
Located in Monroe County
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Complete Body
New York, New York 10005
1-212-248-3033
completebody.com
Located in New York County
  • Electronic Commerce
  • Health Clubs and Gyms

Cooperstown Crier
Cooperstown, New York 13326
1-607-547-9493
cooperstowncookie.com
Located in Otsego County
  • Commercial Printing
  • Electronic Commerce
  • Newspaper Publishers

Copper Shop Gallery
East Aurora, New York 14052
1-716-655-0261
roycroftcampuscorporation.com
Located in Erie County
  • Art Galleries and Dealers
  • Electronic Commerce
  • Museums

Copy Cats Inc
New York, New York 10017
1-212-557-2039
copycats.com
Located in New York County
  • Copying and Duplicating Services
  • Electronic Commerce

Corkbuzz Wine Studio
New York, New York 10003
1-646-873-6071
www.corkbuzz.com
Located in New York County
  • American Restaurants
  • Bars and Pubs
  • Caterers
  • Electronic Commerce

Cornell University - Ornithology Laboratory Of
Ithaca, New York 14850
1-607-254-2473
birds.cornell.edu
Located in Tompkins County
  • Arcades and Amusements
  • Electronic Commerce
  • Government Contractors
  • Outdoor Sports and Recreation
  • Video Games

Costumer
Albany, New York 12205
1-518-464-9033
www.thecostumer.com/
Located in Albany County
  • Costumes
  • Electronic Commerce
  • Masquerade and Theatrical Costumes Sales and Rental

CPR 123
New York, New York 10016
1-212-213-1404
www.cpr123.com
Located in New York County
  • Electronic Commerce
  • Medical Services

Cracker Box Palace
Alton, New York 14413
1-315-483-2493
crackerboxpalace.org
  • Animal Shelters
  • Electronic Commerce

David J MC Lellan Funeral
Ogdensburg, New York 13669
1-315-393-4510
foxandmurrayfuneralhome.com
Located in Saint Lawrence County
  • Electronic Commerce
  • Funeral Homes and Directors

Davis International
Fairport, New York 14450
1-585-421-8707
www.davisint.com
Located in Monroe County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors

Denim Therapy Co
New York, New York 10018
1-347-935-0089
www.denimtherapy.com
Located in New York County
  • Alterations and Tailoring
  • Electronic Commerce

Dissident Books Limited
New York, New York 10075
1-646-422-3100
www.dissidentbooks.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

DIVERSIPAK LLC
Rochester, New York 14609
1-585-455-6776
www.divpak.com
Located in Monroe County
  • Electronic Commerce
  • Internet Products and Services

Doppledecker Design Inc
Port Washington, New York 11050
1-516-883-5184
doppeldecker.aero
Located in Nassau County
  • Clothing Stores
  • Electronic Commerce

E Promos Promotional Product Inc
New York, New York 10271
1-212-286-8008
www.epromos.com
Located in New York County
  • Electronic Commerce
  • Internet Advertising
  • Television Advertising

Edge Color Graphics Inc
Rochester, New York 14605
1-585-546-3950
edgecolorgraphics.com
Located in Monroe County
  • Computer Graphics and Imaging
  • Electronic Commerce
  • Medical Imaging
  • Medical Laboratories

Electrostatic Answers
Fairport, New York 14450
1-585-425-8158
electrostaticanswers.com
Located in Monroe County
  • Electronic Commerce

Epoch Fashion & Accessories Corporation
New York, New York 10001
1-212-683-0758
epochhats.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Eugenia Kim Inc
New York, New York 10018
1-212-674-1345
www.eugeniakim.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Fairdale Townhomes
Farmington, New York 14425
1-585-924-3060
www.fairdaletownhomes.com
Located in Ontario County
  • Apartments
  • Electronic Commerce

First Unitarian Society
Schenectady, New York 12308
1-518-374-4452
www.fussonline.org
Located in Schenectady County
  • Christian Churches
  • Churches
  • Electronic Commerce

Flexible Business Systems Inc
Hauppauge, New York 11788
1-631-756-0589
flexiblesystems.com
Located in Suffolk County
  • Computer Consultants
  • Computer Networks
  • Electronic Commerce
  • Government Contractors

Focus Features
New York, New York 10012
1-212-539-4099
www.focusfeatures.com
Located in New York County
  • Electronic Commerce

Fresh & Organic Salon
Trumansburg, New York 14886
1-607-387-6882
www.fresh-organic-hair.com
Located in Tompkins County
  • Barbers
  • Beauty Salons
  • Electronic Commerce

Friends Of John Jay Homestead
Katonah, New York 10536
1-914-232-5974
www.johnjayhomestead.org
Located in Westchester County
  • Attorneys
  • Electronic Commerce

Friends Of The Rockefeller
Tarrytown, New York 10591
1-914-762-0209
friendsrock.org
Located in Westchester County
  • Community and Civic Organizations
  • Electronic Commerce

Front of House POS
New York, New York 10005
1-800-901-1354
www.fohpos.com/
Located in New York County
  • Electronic Commerce

Furla Inc
New York, New York 10016
1-212-685-5910
furla.com
Located in New York County
  • Electronic Commerce

Future Stars Camps
Armonk, New York 10504
1-914-273-8506
www.fscamps.com
Located in Westchester County
  • Baseball Clubs and Parks
  • Camps
  • Electronic Commerce
  • Sports Camps

FXCM Holdings LLC
New York, New York 10041
1-646-897-7669
fxcm.com
Located in New York County
  • Electronic Commerce
  • Investment Securities
  • Stock and Bond Brokers

Gems
New York, New York 10039
1-212-926-8089
www.gems-girls.org
Located in New York County
  • Business Education
  • Electronic Commerce
  • Schools
  • Social and Human Services Organizations

Geneva Public Library
Geneva, New York 14456
1-315-789-9835
genevapubliclibrary.net
Located in Ontario County
  • Adult and Continuing Education
  • Electronic Commerce
  • Government Contractors
  • Reading Improvement Instruction

Giggle
New York, New York 10021
1-800-495-8577
www.giggle.com
Located in New York County
  • Department Stores
  • Electronic Commerce

Global Industrial Equipment
Port Washington, New York 11050
1-516-625-0038
globalindustrial.com
Located in Nassau County
  • Electronic Commerce
  • Industrial Equipment and Supplies Dealers

Global Purchasing
New York, New York 10010
1-212-414-4001
globalpurchasinggroup.com
Located in New York County
  • Electronic Commerce

GPS TRACKER SERVICE
BAYSIDE, New York 11360
1-718-840-7448
www.gpstrackerservice.com
Located in Queens County
  • Electronic Commerce
  • GPS Navigation and Tracking

Grace Community Church
Painted Post, New York 14870
1-607-937-8171
www.gracecorning.org
Located in Steuben County
  • Churches
  • Electronic Commerce

Graceland Florist
Mount Vernon, New York 10552
1-914-664-3394
gracelandflorist.com
Located in Westchester County
  • Electronic Commerce
  • Florists

Great Neck P A L
Great Neck, New York 11023
1-516-482-7257
www.greatneckpal.com
Located in Nassau County
  • Civic Clubs and Organizations
  • Electronic Commerce

Greg Norman Collection
New York, New York 10018
1-646-840-5200
gregnormancollection.com
Located in New York County
  • Electronic Commerce
  • Shoe Stores
  • Sportswear Retail

H G Fairfield Arts Center
Brewster, New York 10509
1-914-232-1147
hgfairfieldarts.org
Located in Putnam County
  • Arts Organizations and Information
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Harlem Skin Clinic
New York, New York 10026
1-917-309-6607
www.harlemskinclinic.com
Located in New York County
  • Barbers
  • Beauty Salons
  • Electronic Commerce
  • Skin Care Products

Heart-Catskills Humane Society
Delhi, New York 13753
1-607-746-7896
heartofthecatskills.org
Located in Delaware County
  • Animal Hospitals
  • Animal Shelters
  • Electronic Commerce
  • Pet Cemeteries
  • Veterinarians

Electronic Commerce News
Recent news headlines
about the topic Electronic Commerce
from diverse news sources.
news.regionaldirectory.us/electronic-commerce.php
  • Electronic Commerce news image

HeBS Digital
New York, New York 10019
1-212-752-8186
www.hebsdigital.com
Located in New York County
  • Advertising Production Services
  • Commercial Printing
  • Electronic Commerce

Hedonist Chocolates
Rochester, New York 14620
1-585-461-2815
www.hedonistchocolates.com
Located in Monroe County
  • Candy and Confectionery Retail
  • Chocolate and Cocoa Retail
  • Electronic Commerce

His Majesty International Fellowship
Brooklyn, New York 11216
1-347-663-2103
hismajestyinternational.org
Located in Kings County
  • Church and Religious Associations and Organizations
  • Churches
  • Electronic Commerce

History Channel
New York, New York 10017
1-212-210-9755
history.com
Located in New York County
  • Cable Television Services
  • Electronic Commerce
  • Satellite Equipment and System Dealers
  • Satellite Television Services

Hospice Of Orleans County Inc
Albion, New York 14411
1-585-589-5304
www.hospiceoforleans.org
Located in Orleans County
  • Electronic Commerce

Hudson Valley Furniture Service
Ossining, New York 10562
1-914-762-2833
www.myfurnitureguy.com/
Located in Westchester County
  • Electronic Commerce

Hudson Valley Seed Library LLC
Accord, New York 12404
1-845-204-8769
seedlibrary.org
Located in Ulster County
  • Electronic Commerce
  • Libraries

Husaon Mohawk Press
Latham, New York 12110
1-518-618-4651
www.hudsonmohawkpress.com
Located in Albany County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Infinibrand
Yorktown Heights, New York 10598
1-914-302-2185
infinibrand.com
Located in Westchester County
  • Electronic Commerce
  • Professional and Trade Associations

Infinite Shoes Downtown
New York, New York 10013
1-212-966-5210
www.infinityshoes.com
Located in New York County
  • Electronic Commerce
  • Shoe Stores

Influence Graphics
New York, New York 10001
1-212-354-1015
www.influencegraphics.com
Located in New York County
  • Commercial Printing
  • Computer Printers
  • Digital Printers
  • Electronic Commerce

International Institute
New York, New York 10065
1-212-753-0846
www.isadoraduncan.net
Located in New York County
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

Jewelry Doctor Of New York
New York, New York 10036
1-646-560-0629
www.jewelryrepairnewyork.com
Located in New York County
  • Electronic Commerce
  • Jewelry Repair

Jewelry Nest
Woodmere, New York 11598
1-516-569-9267
www.jewelrynest.com
Located in Nassau County
  • Electronic Commerce
  • Jewelry Designers
  • Jewelry Wholesale and Manufacturers

Jildor Shoes
Great Neck, New York 11021
1-516-487-6464
www.jildorshoes.com
Located in Nassau County
  • Electronic Commerce
  • Shoe Stores

JMS & Eva Limited
New York, New York 10065
1-212-593-1113
jmseva.com
Located in New York County
  • Antique Dealers
  • Antiques
  • Electronic Commerce

Jonathan Levine Gallery
New York, New York 10011
1-212-243-3822
www.jonathanlevinegallery.com
Located in New York County
  • Art Galleries and Dealers
  • Electronic Commerce

Junior League Of Syracuse
Syracuse, New York 13202
1-315-423-9773
www.jlsyracuse.com
Located in Onondaga County
  • Civic Clubs and Organizations
  • Electronic Commerce
  • Youth Organizations, Centers and Clubs

K & L Soaring LLC
Cayuta, New York 14824
1-607-594-3329
klsoaring.com
Located in Schuyler County
  • Aircraft Modification and Overhaul
  • Electronic Commerce

Kashkaval Foods Limited
New York, New York 10019
1-212-581-8282
www.kashkavalfoods.com
Located in New York County
  • Cheese Shops
  • Electronic Commerce

Kenjo Watches
New York, New York 10019
1-212-402-7000
www.kenjo.net
Located in New York County
  • Electronic Commerce
  • Watches Retail

Kirna Zabete
New York, New York 10013
1-212-941-9656
www.kirnazabete.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Knapp Farm
Lowman, New York 14861
1-607-733-5269
knappfarm.net
Located in Chemung County
  • Electronic Commerce

Kyriba Corporation
New York, New York 10006
1-212-784-5581
www.kyriba.com
Located in New York County
  • Computer Software
  • Electronic Commerce

L-Tron Corporation
Victor, New York 14564
1-585-383-0050
l-tron.com
Located in Ontario County
  • Electronic Commerce

Label Shopper
Amenia, New York 12501
1-845-373-9066
labelshopper.com
Located in Dutchess County
  • Clothing Stores
  • Electronic Commerce

Lake George Arts Project
Lake George, New York 12845
1-518-668-2616
www.lakegeorgearts.org
Located in Warren County
  • Arts Organizations and Information
  • Electronic Commerce

Lemoyne College Bookstore
Syracuse, New York 13214
1-315-251-0300
lemoyne.edu
Located in Onondaga County
  • Bookstores
  • Electronic Commerce

Lens Land
New Hyde Park, New York 11040
1-516-775-2485
www.eyeglasses123.com
Located in Nassau County
  • Contact Lenses
  • Electronic Commerce
  • Optical Goods Retail

Life Science Pharmacy Inc
Harriman, New York 10926
1-845-781-7613
www.lifesciencepharmacy.com
Located in Orange County
  • Drug Stores and Pharmacies
  • Electronic Commerce

Little Bird Nail Salon
Hampton Bays, New York 11946
1-631-723-1118
www.littlebirdnails.com
Located in Suffolk County
  • Beauty Salons
  • Electronic Commerce
  • Manicures and Pedicures

Local Galaxy Web Development
New York, New York 10009
1-212-254-7358
localgalaxy.com
Located in New York County
  • Electronic Commerce
  • Web Site Design

Long Islands Seo
Centerport, New York 11721
1-631-807-5332
www.longislandsseo.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Advertising
  • Internet Service Providers

M1-5
New York, New York 10013
1-212-965-1701
www.m1-5.com
Located in New York County
  • Bars and Pubs
  • Electronic Commerce

Map-It Inc
New York, New York 10017
1-800-929-6163
www.mapitinc.com
Located in New York County
  • Electronic Commerce
  • Graphics Services
  • Internet Service Providers
  • Web Site Design

Mark Grimm Communications
Schenectady, New York 12303
1-518-356-4865
www.markgrimm.com
Located in Schenectady County
  • Electronic Commerce

Martial Vivot LLC
New York, New York 10019
1-212-956-2990
martialvivot.com
Located in New York County
  • Barbers
  • Beauty Salons
  • Electronic Commerce

Mary Learner Of Cedarhurst
Cedarhurst, New York 11516
1-516-569-3150
www.shopcedarhurst.com
Located in Nassau County
  • Bras and Girdles Retail
  • Clothing Stores
  • Electronic Commerce

Match Show Bulletin
Massapequa, New York 11758
1-516-541-3442
www.matchshowbulletin.com
Located in Nassau County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

Maternity Center Association
New York, New York 10016
1-212-369-8747
childbirthconnection.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Government Contractors

Medical Letter Inc
New Rochelle, New York 10801
1-914-576-3377
www.medicalletter.com
Located in Westchester County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors
  • Magazine and Journal Publishers

Mediterranean Roofing & DSGNS
Great Neck, New York 11021
1-516-605-1530
www.clayroofs.com
Located in Nassau County
  • Building Contractors
  • Electronic Commerce
  • Roofing Contractors

Memories Funeral Home
Rochester, New York 14621
1-585-544-4929
memoriesfuneralhome.com
Located in Monroe County
  • Cremation Services
  • Electronic Commerce
  • Funeral Homes and Directors
  • Funeral Services

Mibar Computer Service
New York, New York 10018
1-212-869-9350
www.mibar.net
Located in New York County
  • Electronic Commerce

Miles Car Rental New York
New York, New York 10001
1-347-630-0669
www.milescarrentalnewyork.com
Located in New York County
  • Auto Rental
  • Electronic Commerce

MLB Advanced Media LP
New York, New York 10011
1-212-485-3456
pressbox.mlb.com
Located in New York County
  • Electronic Commerce
  • Sports and Recreation Clubs and Organizations

Mobile Programming LLC
New York, New York 10006
1-212-688-6950
www.mobileprogramming.com
Located in New York County
  • Electronic Commerce

Montauk Friends of Erin
Montauk, New York 11954
1-631-668-1578
www.montaukfriendsoferin.com
Located in Suffolk County
  • Electronic Commerce

Mood Makers Books
Rochester, New York 14607
1-585-271-7010
www.moodmakersbooks.com
Located in Monroe County
  • Art Galleries and Dealers
  • Bookstores
  • Electronic Commerce

Morgen Stern School
Woodmere, New York 11598
1-516-374-2704
csoiwoodmere.com
Located in Nassau County
  • Electronic Commerce

Myworldphone.com
New York, New York 10118
1-212-438-3210
myworldphone.com
Located in New York County
  • Cell Phone Services
  • Electronic Commerce

Newburgh Envelope Corporation
Newburgh, New York 12550
1-845-566-4211
www.newburghenvelope.biz
Located in Orange County
  • Commercial Printing
  • Electronic Commerce
  • Printing Services

News Department Bureau Offices
Canton, New York 13617
1-315-386-3571
watertowndailytimes.com
Located in Saint Lawrence County
  • Commercial Printing
  • Electronic Commerce
  • Newspaper Publishers

Niagra Tradition Home Brewing
Buffalo, New York 14217
1-716-877-8767
www.nthomebrew.com
Located in Erie County
  • Electronic Commerce
  • Winemaking Equipment and Supplies

Nyscate
Latham, New York 12110
1-518-786-3981
nyscate.org
Located in Albany County
  • Business Education
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

Oakhurst Co
Levittown, New York 11756
1-516-731-5607
oakhurst-medicine.com
Located in Nassau County
  • Drug Stores and Pharmacies
  • Electronic Commerce

Oberoi Hotels & Resorts
New York, New York 10022
1-212-223-8500
oberoihotels.com
Located in New York County
  • Electronic Commerce

Oddcast Inc
New York, New York 10018
1-212-279-7053
oddcast.com
Located in New York County
  • Electronic Commerce
  • Web Site Design

Office Of Paul Sahre
New York, New York 10011
1-212-741-7739
paulsahre.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Olde Bryan Inn
Saratoga Springs, New York 12866
1-518-587-4316
oldebryaninn.com
Located in Saratoga County
  • American Restaurants
  • Electronic Commerce
  • Restaurants

Oneonta Community Christian
Oneonta, New York 13820
1-607-436-9137
www.occseagles.org
Located in Otsego County
  • Electronic Commerce

Ooyala Inc
New York, New York 10003
1-646-237-5848
ooyala.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers

Opt-Intelligence
New York, New York 10018
1-212-594-3862
opt-intelligence.com
Located in New York County
  • Builders and Contractors
  • Building and Home Construction
  • Building Contractors
  • Construction Companies
  • Electronic Commerce
  • Home Builders and Developers

Orbus Software
New York, New York 10022
1-212-931-8021
www.orbussoftware.com
Located in New York County
  • Computer and Equipment Dealers
  • Computer Printers
  • Electronic Commerce

Osteopathy New York PC
New York, New York 10003
1-212-226-6264
www.osteopathyny.com
Located in New York County
  • Electronic Commerce

Outdoor Bound Inc
New York, New York 10013
1-212-579-4568
discoveroutdoors.com
Located in New York County
  • Climbing, Hiking and Backpacking
  • Electronic Commerce
  • Outdoor Sports and Recreation
  • Wildlife Services

Oxford Seminars
New York, New York 10001
1-800-779-1779
www.oxfordseminars.com
Located in New York County
  • Business Education
  • Electronic Commerce
  • Schools

ozEworks, Inc
Brooklyn, New York 11209
1-718-336-4760
www.ozEworks.com
Located in Kings County
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Internet Services
  • Virtual Hosting Providers

Park Side Candy Co
Buffalo, New York 14219
1-716-824-5303
www.parksidecandy.com
Located in Erie County
  • Candy and Confectionery Wholesale and Manufacturers
  • Electronic Commerce

Parliament Tutors
White Plains, New York 10605
1-914-417-9202
www.parliamenttutors.com
Located in Westchester County
  • Colleges and Universities
  • Electronic Commerce
  • Test Preparation and Tutoring Services

Payvision
New York, New York 10013
1-917-237-0900
www.payvision.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers
  • Mail Order and Catalog Sales

Perfect Choice Trading INC
New York, New York 10013
1-212-475-2732
www.choiceofbeauty.com
Located in New York County
  • Electronic Commerce

Perfective Ceuticals LLC
Uniondale, New York 11553
1-646-257-2032
perfectiveceuticals.com
Located in Nassau County
  • Electronic Commerce

Pet Business
New York, New York 10001
1-212-979-4861
www.groceryheadquarters.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

Pfeil Hardware LLC
Troy, New York 12180
1-518-687-0014
www.pfeilhardware.com
Located in Rensselaer County
  • Electronic Commerce
  • Hardware Dealers

Pigeons In Combat
New York, New York 10010
1-212-677-6833
pigeonsincombat.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers

Pioneer Services
Evans Mills, New York 13637
1-315-629-1526
www.pioneermilitaryloans.com/fortdrum
Located in Jefferson County
  • Electronic Commerce
  • Mortgage and Loan Banks

Plainview Carpet Cleaning Professional
Plainview, New York 11803
1-516-252-1732
mrcarpetcleaningplainviewny.weebly.com
Located in Nassau County
  • Carpet, Rug and Upholstery Cleaning
  • Carpet, Rug and Upholstery Storage and Repair
  • Electronic Commerce

PRC Industries
Saint James, New York 11780
1-631-750-9600
www.prcind.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Products and Services

Profit Partner Solution
Depew, New York 14043
1-800-519-7800
www.profitpartnersolutions.com/
Located in Erie County
  • Electronic Commerce
  • Internet Marketing Services
  • Logos
  • Web Site Design

Publishers Weekly
New York, New York 10010
1-212-377-5500
publishersweekly.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers
  • Publishers

Raktrul Foundation
Red Hook, New York 12571
1-845-758-9392
raktrulfoundation.org
Located in Dutchess County
  • Electronic Commerce

Red Flower Retail
New York, New York 10012
1-212-966-5301
redflower.com
Located in New York County
  • Electronic Commerce

Riding Right Farm
Buskirk, New York 12028
1-518-677-5148
www.ridingfarm.com
  • Electronic Commerce

Ritz Tours & Travel Inc
New York, New York 10017
1-212-973-1998
ritztours.com
Located in New York County
  • Electronic Commerce

Roberts Eyecare Associate - Subadra Arunagirinatha Od
Vestal, New York 13850
1-607-722-3937
robertseyecare.net
Located in Broome County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

Roberts Eyecare Associate - Tammy Carlson Od
Vestal, New York 13850
1-607-722-3937
www.robertseyecare.net/
Located in Broome County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

Rochester Business Journal Inc
Rochester, New York 14604
1-585-546-3398
www.rbj.net
Located in Monroe County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers
  • Newspaper Publishers

Rochester Education Foundation
Rochester, New York 14614
1-585-271-5790
www.rochestereducation.org
Located in Monroe County
  • Electronic Commerce

Rochester Regional Community DSGN
Rochester, New York 14609
1-585-271-0520
www.rrcdc.org
Located in Monroe County
  • Counseling Services
  • Electronic Commerce
  • Social and Human Services Organizations
  • Social and Human Services

Routledge
New York, New York 10016
1-212-695-6599
www.routledge.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Publishers

RPNY Tennis
New York, New York 10022
1-212-980-1555
www.rpnytennis.com
Located in New York County
  • Electronic Commerce

Rusty Brick Inc
West Nyack, New York 10994
1-877-467-8789
rustybrick.com
Located in Rockland County
  • Electronic Commerce
  • Web Site Design

Rye Eye Care - Steven S Bloom Od
Rye, New York 10580
1-914-967-1632
www.ryeeyecare.com
Located in Westchester County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

S&P Capital Iq Inc
New York, New York 10041
1-212-438-8710
capitaliq.com
Located in New York County
  • Electronic Commerce

Santelli Lumber Co
Palmyra, New York 14522
1-315-597-6191
www.santellilumber.com
Located in Wayne County
  • Building Materials and Supplies Dealers
  • Electronic Commerce
  • Lumber Dealers

Service Employees Intl Union
Buffalo, New York 14226
1-716-631-3929
www.seiu200united.org
Located in Erie County
  • Electronic Commerce
  • Labor Organizations

Service Now
New York, New York 10165
1-212-490-9633
www.service-now.com
Located in New York County
  • Computer Software
  • Electronic Commerce

Shawn L Watson Hemphil
Rochester, New York 14621
1-585-544-4931
memoriesfuneralhome.com
Located in Monroe County
  • Electronic Commerce
  • Funeral Homes and Directors

Shelters Of Saratoga Inc
Saratoga Springs, New York 12866
1-518-581-1097
www.sheltersofsaratoga.com
Located in Saratoga County
  • Electronic Commerce


Singer 22
Roslyn Heights, New York 11577
1-516-626-1600
singer22.com
Located in Nassau County
  • Clothing Stores
  • Electronic Commerce

Skyhorse Publishing Inc
New York, New York 10018
1-212-643-6816
www.skyhorsepublishing.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Sneakers For You 18 LLC
Hicksville, New York 11802
1-516-433-3766
sneakers4u.com
Located in Nassau County
  • Electronic Commerce
  • Shoe Stores

Sphatika International
New York, New York 10023
1-212-265-5885
www.sphatika.com
Located in New York County
  • Beauty and Day Spas
  • Beauty Salons
  • Electronic Commerce

Streetid
New York, New York 10004
1-646-783-7523
www.streetid.com
Located in New York County
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

Subscriber Hot Line
New York, New York 10018
1-212-333-4052
primarystages.org
Located in New York County
  • Electronic Commerce
  • Live Theater

Super Market Parts Replacement
Mountain Dale, New York 12763
1-800-767-9855
smpw.com
Located in Sullivan County
  • Electronic Commerce
  • Fruits and Vegetables
  • Grocery Stores and Supermarkets

Tateossian
New York, New York 10016
1-212-213-6119
www.tateossian.com
Located in New York County
  • Electronic Commerce

Teneues Publishing Co
New York, New York 10011
1-212-627-9511
teneues.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Teri Jon Inc
New York, New York 10018
1-212-302-2726
terijon.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Texas Monthly
New York, New York 10165
1-212-949-4292
www.texasmonthly.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

The Drawing Center
New York, New York 10013
1-212-966-2976
www.drawingcenter.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Government Contractors
  • Importers

The Gershwin Theatre
New York, New York 10019
1-212-586-6510
www.gershwintheatre.com
Located in New York County
  • Electronic Commerce

Torcomp Inc
Sanborn, New York 14132
1-716-731-9090
www.studica.com
Located in Niagara County
  • Computer Software
  • Electronic Commerce
  • Government Contractors

Two Little Hands Training Center
New York, New York 10032
1-917-627-3785
www.twolittlehandstc.com
Located in New York County
  • Electronic Commerce

Ukrainian Church Holy Family
Lindenhurst, New York 11757
1-631-225-1168
holyfamilyucc.com
Located in Suffolk County
  • Churches
  • Electronic Commerce

Unreal Web Marketing
Port Jefferson, New York 11777
1-631-828-5227
www.unrealstudio.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Marketing Services
  • Web Site Developers

Viscusi Wholesale Grocers Inc
Schenectady, New York 12303
1-518-377-8269
www.casavisco.com
Located in Schenectady County
  • Electronic Commerce

Web Studios
New York, New York 10019
1-212-786-6026
www.webstudios.com
Located in New York County
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Web Site Design

Westchester Magazine
Elmsford, New York 10523
1-914-345-0601
www.westchestermagazine.com
Located in Westchester County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

WNET
New York, New York 10019
1-212-560-1313
wnet.org
Located in New York County
  • Electronic Commerce

WORX working communication
New York, New York 10005
1-646-238-2733
www.worxweb.com
Located in New York County
  • Electronic Commerce
  • Internet Marketing Services

WPIX
New York, New York 10017
1-212-210-2681
wpix.com
Located in New York County
  • Bed and Breakfasts
  • Electronic Commerce
  • Television Stations

You Are Beautiful People Inc
Warwick, New York 10990
1-845-986-5944
beautiful-people.us
Located in Orange County
  • Electronic Commerce
  • Youth Organizations, Centers and Clubs

YRB NYC
New York, New York 10013
1-212-219-8569
www.yellowratbastard.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce
  • Sportswear Retail

Zeitgeist Films
New York, New York 10013
1-212-274-1989
zeitgeistfilms.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors
  • Photofinishing Retail

Electronic Commerce in Adjacent States

New York Directory and Map Pages


Related New York Page(s)

new-york web site hosting servers and a caption
New York Web Site Hosting
new-york web site HTML code
New York Web Site Developers
new-york a 20th century mainframe computer used for data processing
New York Data Processing Services


228 e-commerce service providers listed in New York.
Copyright © 2010- RegionalDirectory.us.  All rights reserved.
Click "☎ & 🔍" for mobile-friendly phone link & locator map pages.

New York Electronic Commerce