Electronic Commerce  

New York E-Commerce Providers

 
   

USA Regional Directory > Electronic Commerce > New York

Submit a Website
 
This web page lists e-commerce service providers in the State of New York.  Before visiting any of these New York e-commerce service providers, be sure to verify their address, hours of operation, and appointment requirements (if any).  An e-commerce service may have ceased operations or moved to a different address, and business hours can sometimes vary, especially on and around holidays.  So a quick phone call can often save you time and aggravation.

a conceptual e-commerce illustration - with New York icon

Related directory pages are highlighted below the New York e-commerce service listings on this page.  Links to E-Commerce directory pages for adjacent States are provided at the bottom of the page.  New York directory and map page links are also included there.


1800 Printing Inc
New York, New York 10016
1-212-945-8711
www.1800printingny.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Print Brokers
  • Printing Consultants

540 Park Restaurant
New York, New York 10065
1-212-826-5674
www.loewshotels.com/en/Regency-Hotel/dining/restaurants
Located in New York County
  • American Restaurants
  • Electronic Commerce
  • Restaurants

A J Foreign Auto
Ithaca, New York 14850
1-607-272-1324
ajforeignauto.com/
Located in Tompkins County
  • Auto Inspection
  • Auto Service and Repair
  • Electronic Commerce

A Votre Service Events LLC
New York, New York 10014
1-800-757-0549
avsevent.com
Located in New York County
  • Banquet Facilities
  • Electronic Commerce
  • Event Planning
  • Party Planning
  • Wedding Planners

Accentuating Service
New York, New York 10065
1-212-688-6506
www.accentuatingservice.com
Located in New York County
  • Adult and Continuing Education
  • Business and Personal Coaching
  • Electronic Commerce

Advertising Age
New York, New York 10017
1-212-210-0200
www.adage.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

Albany Fashions
Albany, New York 12211
1-518-271-7488
www.albanyfashions.com
Located in Albany County
  • Clothing Stores
  • Electronic Commerce

Albany Print Inc
Albany, New York 12206
1-518-633-1458
www.albanyprint.com
Located in Albany County
  • Commercial Printing
  • Copying and Duplicating Services
  • Electronic Commerce
  • Printing Services

Always Ready Locksmith
New York, New York 10023
1-212-873-2238
alwaysreadylocksmith.com
Located in New York County
  • Electronic Commerce

American Handicap Defense Fund
Binghamton, New York 13901
1-607-724-3596
disablelaw.org
Located in Broome County
  • Electronic Commerce

American Mailbox
Niagara Falls, New York 14303
1-716-236-7299
www.americanmailbox.net
Located in Niagara County
  • Custom Auto Painting
  • Electronic Commerce
  • Mailboxes Retail

Ancare Corporation
Bellmore, New York 11710
1-516-781-4937
ancare.com
Located in Nassau County
  • Electronic Commerce

Antiquarian Booksellers Association
New York, New York 10036
1-212-944-8293
www.abaa.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Professional and Trade Associations
  • Residential Care Facilities

Arabic Virtual Translation Center
New York, New York 10016
1-212-697-0513
www.avtcllc.com
Located in New York County
  • Electronic Commerce
  • Language Schools and Instruction
  • Translators and Interpreters

Arcade Classics
New York, New York 10001
1-212-361-9103
www.arcadeclassics.net
Located in New York County
  • Arcade Games and Machines
  • Electronic Commerce
  • Video Games

Armenian Educational
Congers, New York 10920
1-845-268-2069
armenianmedicalfund.com
Located in Rockland County
  • Business Education
  • Electronic Commerce

Arrow Express
New York, New York 10013
1-212-714-1986
www.arrowexpress.com
Located in New York County
  • Electronic Commerce
  • Freight Forwarding

Art Guard LLC
New York, New York 10011
1-212-989-1594
artguard.net
Located in New York County
  • Art Supplies Retail
  • Electronic Commerce

ARZA
New York, New York 10017
1-212-650-4280
arza.org
Located in New York County
  • Electronic Commerce

Atm Supply
Buffalo, New York 14207
1-716-855-3417
atmsupplyco.com
Located in Erie County
  • Electronic Commerce
  • Fasteners

Av Source
New York, New York 10016
1-212-689-4016
www.avsourceny.com
Located in New York County
  • Electronic Commerce

Ba Cleaning Service Etc
New York, New York 10030
1-212-234-9807
www.nyfullservicecleaning.com
Located in New York County
  • Cleaning Services
  • Electronic Commerce
  • Housecleaning
  • Maids and Butlers
  • Office Building and Industrial Cleaning Services

Babesta
New York, New York 10007
1-212-504-8107
babesta.com
Located in New York County
  • Electronic Commerce

Bank Leumi Leasing Corporation
New York, New York 10036
1-212-626-1271
leumiusa.com
Located in New York County
  • Banks
  • Commercial and Industrial Rental and Leasing
  • Electronic Commerce
  • Tool Rental and Leasing

Bare Body Collection LLC
New York, New York 10028
1-917-703-3535
barebodycollection.com
Located in New York County
  • Electronic Commerce

Bateaux
New York, New York 10011
1-212-352-9009
bateauxnewyork.com
Located in New York County
  • Electronic Commerce

Benchmark Computer Solutions
Syosset, New York 11791
1-516-921-0095
www.benchmarkcs.com
Located in Nassau County
  • Business Services
  • Computer Consultants
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Network Solutions

Beretta Gallery
New York, New York 10065
1-212-319-3235
www.berettausa.com
Located in New York County
  • Electronic Commerce

Bible Literacy Project
New York, New York 10029
1-212-348-8634
bibleliteracy.org
Located in New York County
  • Church and Religious Associations and Organizations
  • Churches
  • Electronic Commerce

Big City Sportswear & Graphics
Rochester, New York 14624
1-585-594-1118
www.bigcitysportswear.com
Located in Monroe County
  • Electronic Commerce
  • Embroidery Service
  • Screen Printing
  • T-Shirts Retail

Bike World Usa
Schenectady, New York 12302
1-518-831-1751
bikeworldusa.com
Located in Schenectady County
  • Electronic Commerce

Biovericom
Troy, New York 12180
1-518-273-1090
www.biovericom.com
Located in Rensselaer County
  • Community and Civic Organizations
  • Electronic Commerce

Bizpup Website Provders
Buffalo, New York 14214
1-716-836-3457
www.bizpup.com/contact
Located in Erie County
  • Electronic Commerce
  • Information Technology Services
  • Internet Advertising
  • Internet Domain Registration and Brokering
  • Internet Products and Services
  • Internet Services
  • Web Sites

Blitman & King
Latham, New York 12110
1-518-785-4387
www.bklawyers.com/
Located in Albany County
  • Electronic Commerce

Blue And Cream LLC
East Hampton, New York 11937
1-631-329-1392
www.blueandcream.com
Located in Suffolk County
  • Clothing Stores
  • Electronic Commerce

Bond No 9
New York, New York 10021
1-212-794-4480
bondno9.com
Located in New York County
  • Electronic Commerce
  • Perfumes and Colognes Retail

Book Smart Studio
Rochester, New York 14607
1-585-730-8320
booksmartstudio.com
Located in Monroe County
  • Commercial Printing
  • Copying and Duplicating Services
  • Electronic Commerce
  • Photofinishing Retail

Bounkit Design
New York, New York 10001
1-212-244-1877
www.bounkit.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Brighton-Eggert Animal Clinic - Julia I Miska DVM
Tonawanda, New York 14150
1-716-833-4266
www.brightoneggert.com
Located in Erie County
  • Electronic Commerce
  • Veterinarians

British Tools & Fasteners LLC
Lyons, New York 14489
1-315-946-9400
britishfasteners.com
Located in Wayne County
  • Antique and Classic Auto Parts
  • Antiques
  • Electronic Commerce

Broome Obstetrics & Gynecology - Kathleen B Buglione MD
Binghamton, New York 13905
1-607-770-7074
broomeobgyn.com
Located in Broome County
  • Electronic Commerce
  • General Practice
  • Midwives
  • Nurse Practitioners

Broome Obstetrics & Gynecology - Michael A Farrell MD
Binghamton, New York 13905
1-607-770-7074
www.broomeobgyn.com/
Located in Broome County
  • Electronic Commerce

Buffalo Hotel Supply
Guilderland, New York 12084
1-888-838-8020
buffalohotelsupply.com
Located in Albany County
  • Electronic Commerce

Buffalo Water Filtration Plant
Buffalo, New York 14201
1-716-851-4731
ci.buffalo.ny.us
Located in Erie County
  • Electronic Commerce
  • Water and Sewage Companies

C Gerard Marketing
Amsterdam, New York 12010
1-800-219-4299
cgerardmarketing.com
Located in Montgomery County
  • Advertising Specialties Wholesale and Manufacturers
  • Electronic Commerce

Cambridge Corporate Service
New York, New York 10004
1-212-425-2882
cambridgeservices.com
Located in New York County
  • Business Brokers
  • Electronic Commerce

Camp Che Na Wah
Minerva, New York 12851
1-518-251-3129
campbaco.com
Located in Essex County
  • Camps
  • Electronic Commerce
  • Sports Camps

Cegid Corporation
New York, New York 10016
1-212-757-9051
cegid.com
Located in New York County
  • Computer Software
  • Electronic Commerce

Centro Altagracia
New York, New York 10032
1-212-568-2118
centroaltagracia.org
Located in New York County
  • Catholic Churches
  • Church and Religious Associations and Organizations
  • Churches
  • Electronic Commerce

Childrens Environmental
Chappaqua, New York 10514
1-914-238-4743
celfeducation.org
Located in Westchester County
  • Electronic Commerce
  • Government Contractors
  • Social Workers

Christ Church United Methodist
Troy, New York 12180
1-518-273-8042
www.christchurchtroy.org
Located in Rensselaer County
  • Churches
  • Electronic Commerce
  • Methodist Churches

Citixsys Technologies
New York, New York 10020
1-212-745-1365
www.citixsys.com
Located in New York County
  • Computer Software
  • Electronic Commerce

Electronic Commerce News
Recent news headlines
about the topic Electronic Commerce
from diverse news sources.
news.regionaldirectory.us/electronic-commerce.php
  • Electronic Commerce news image

City Blossoms Inc
New York, New York 10006
1-212-269-8190
cityblossoms.com
Located in New York County
  • Electronic Commerce

Cmple.com Inc
Brooklyn, New York 11230
1-347-587-6480
cmple.com
Located in Kings County
  • Computer Printers
  • Consumer Electronics Stores
  • Electronic Commerce
  • Electronic Equipment and Supplies Wholesale and Manufacturers

Communist Party Us National Ofc
New York, New York 10011
1-212-229-1713
www.cpusa.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Community Place Of Greater
Rochester, New York 14609
1-585-288-8662
www.communityplace.org
Located in Monroe County
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Complete Body
New York, New York 10005
1-212-248-3033
completebody.com
Located in New York County
  • Electronic Commerce
  • Health Clubs and Gyms

Cooperstown Crier
Cooperstown, New York 13326
1-607-547-9493
cooperstowncookie.com
Located in Otsego County
  • Commercial Printing
  • Electronic Commerce
  • Newspaper Publishers

Copper Shop Gallery
East Aurora, New York 14052
1-716-655-0261
roycroftcampuscorporation.com
Located in Erie County
  • Art Galleries and Dealers
  • Electronic Commerce
  • Museums

Copy Cats Inc
New York, New York 10017
1-212-557-2039
copycats.com
Located in New York County
  • Copying and Duplicating Services
  • Electronic Commerce

Corkbuzz Wine Studio
New York, New York 10003
1-646-873-6071
www.corkbuzz.com
Located in New York County
  • American Restaurants
  • Bars and Pubs
  • Caterers
  • Electronic Commerce

Cornell University - Ornithology Laboratory Of
Ithaca, New York 14850
1-607-254-2473
birds.cornell.edu
Located in Tompkins County
  • Arcades and Amusements
  • Electronic Commerce
  • Government Contractors
  • Outdoor Sports and Recreation
  • Video Games

Costumer
Albany, New York 12205
1-518-464-9033
www.thecostumer.com/
Located in Albany County
  • Costumes
  • Electronic Commerce
  • Masquerade and Theatrical Costumes Sales and Rental

CPR 123
New York, New York 10016
1-212-213-1404
www.cpr123.com
Located in New York County
  • Electronic Commerce
  • Medical Services

Cracker Box Palace
Alton, New York 14413
1-315-483-2493
crackerboxpalace.org
  • Animal Shelters
  • Electronic Commerce

David J MC Lellan Funeral
Ogdensburg, New York 13669
1-315-393-4510
foxandmurrayfuneralhome.com
Located in Saint Lawrence County
  • Electronic Commerce
  • Funeral Homes and Directors

Davis International
Fairport, New York 14450
1-585-421-8707
www.davisint.com
Located in Monroe County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors

Denim Therapy Co
New York, New York 10018
1-347-935-0089
www.denimtherapy.com
Located in New York County
  • Alterations and Tailoring
  • Electronic Commerce

Dissident Books Limited
New York, New York 10075
1-646-422-3100
www.dissidentbooks.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

DIVERSIPAK LLC
Rochester, New York 14609
1-585-455-6776
www.divpak.com
Located in Monroe County
  • Electronic Commerce
  • Internet Products and Services

Doppledecker Design Inc
Port Washington, New York 11050
1-516-883-5184
doppeldecker.aero
Located in Nassau County
  • Clothing Stores
  • Electronic Commerce

E Promos Promotional Product Inc
New York, New York 10271
1-212-286-8008
www.epromos.com
Located in New York County
  • Electronic Commerce
  • Internet Advertising
  • Television Advertising

Edge Color Graphics Inc
Rochester, New York 14605
1-585-546-3950
edgecolorgraphics.com
Located in Monroe County
  • Computer Graphics and Imaging
  • Electronic Commerce
  • Medical Imaging
  • Medical Laboratories

Electrostatic Answers
Fairport, New York 14450
1-585-425-8158
electrostaticanswers.com
Located in Monroe County
  • Electronic Commerce

Epoch Fashion & Accessories Corporation
New York, New York 10001
1-212-683-0758
epochhats.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Eugenia Kim Inc
New York, New York 10018
1-212-674-1345
www.eugeniakim.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Fairdale Townhomes
Farmington, New York 14425
1-585-924-3060
www.fairdaletownhomes.com
Located in Ontario County
  • Apartments
  • Electronic Commerce

First Unitarian Society
Schenectady, New York 12308
1-518-374-4452
www.fussonline.org
Located in Schenectady County
  • Christian Churches
  • Churches
  • Electronic Commerce

Flexible Business Systems Inc
Hauppauge, New York 11788
1-631-756-0589
flexiblesystems.com
Located in Suffolk County
  • Computer Consultants
  • Computer Networks
  • Electronic Commerce
  • Government Contractors

Focus Features
New York, New York 10012
1-212-539-4099
www.focusfeatures.com
Located in New York County
  • Electronic Commerce

Fresh & Organic Salon
Trumansburg, New York 14886
1-607-387-6882
www.fresh-organic-hair.com
Located in Tompkins County
  • Barbers
  • Beauty Salons
  • Electronic Commerce

Friends Of John Jay Homestead
Katonah, New York 10536
1-914-232-5974
www.johnjayhomestead.org
Located in Westchester County
  • Attorneys
  • Electronic Commerce

Friends Of The Rockefeller
Tarrytown, New York 10591
1-914-762-0209
friendsrock.org
Located in Westchester County
  • Community and Civic Organizations
  • Electronic Commerce

Front of House POS
New York, New York 10005
1-800-901-1354
www.fohpos.com/
Located in New York County
  • Electronic Commerce

Furla Inc
New York, New York 10016
1-212-685-5910
furla.com
Located in New York County
  • Electronic Commerce

Future Stars Camps
Armonk, New York 10504
1-914-273-8506
www.fscamps.com
Located in Westchester County
  • Baseball Clubs and Parks
  • Camps
  • Electronic Commerce
  • Sports Camps

FXCM Holdings LLC
New York, New York 10041
1-646-897-7669
fxcm.com
Located in New York County
  • Electronic Commerce
  • Investment Securities
  • Stock and Bond Brokers

Gems
New York, New York 10039
1-212-926-8089
www.gems-girls.org
Located in New York County
  • Business Education
  • Electronic Commerce
  • Schools
  • Social and Human Services Organizations

Geneva Public Library
Geneva, New York 14456
1-315-789-9835
genevapubliclibrary.net
Located in Ontario County
  • Adult and Continuing Education
  • Electronic Commerce
  • Government Contractors
  • Reading Improvement Instruction

Giggle
New York, New York 10021
1-800-495-8577
www.giggle.com
Located in New York County
  • Department Stores
  • Electronic Commerce

Global Industrial Equipment
Port Washington, New York 11050
1-516-625-0038
globalindustrial.com
Located in Nassau County
  • Electronic Commerce
  • Industrial Equipment and Supplies Dealers

Global Purchasing
New York, New York 10010
1-212-414-4001
globalpurchasinggroup.com
Located in New York County
  • Electronic Commerce

GPS TRACKER SERVICE
BAYSIDE, New York 11360
1-718-840-7448
www.gpstrackerservice.com
Located in Queens County
  • Electronic Commerce
  • GPS Navigation and Tracking

Grace Community Church
Painted Post, New York 14870
1-607-937-8171
www.gracecorning.org
Located in Steuben County
  • Churches
  • Electronic Commerce

Graceland Florist
Mount Vernon, New York 10552
1-914-664-3394
gracelandflorist.com
Located in Westchester County
  • Electronic Commerce
  • Florists

Great Neck P A L
Great Neck, New York 11023
1-516-482-7257
www.greatneckpal.com
Located in Nassau County
  • Civic Clubs and Organizations
  • Electronic Commerce

Greg Norman Collection
New York, New York 10018
1-646-840-5200
gregnormancollection.com
Located in New York County
  • Electronic Commerce
  • Shoe Stores
  • Sportswear Retail

H G Fairfield Arts Center
Brewster, New York 10509
1-914-232-1147
hgfairfieldarts.org
Located in Putnam County
  • Arts Organizations and Information
  • Business and Professional Associations and Organizations
  • Electronic Commerce

Harlem Skin Clinic
New York, New York 10026
1-917-309-6607
www.harlemskinclinic.com
Located in New York County
  • Barbers
  • Beauty Salons
  • Electronic Commerce
  • Skin Care Products

Heart-Catskills Humane Society
Delhi, New York 13753
1-607-746-7896
heartofthecatskills.org
Located in Delaware County
  • Animal Hospitals
  • Animal Shelters
  • Electronic Commerce
  • Pet Cemeteries
  • Veterinarians

HeBS Digital
New York, New York 10019
1-212-752-8186
www.hebsdigital.com
Located in New York County
  • Advertising Production Services
  • Commercial Printing
  • Electronic Commerce

Hedonist Chocolates
Rochester, New York 14620
1-585-461-2815
www.hedonistchocolates.com
Located in Monroe County
  • Candy and Confectionery Retail
  • Chocolate and Cocoa Retail
  • Electronic Commerce

New York Information
Encyclopedic article
and related references
about New York.
www.word-cloud.org/new-york.php
  • New York Locator Map

History Channel
New York, New York 10017
1-212-210-9755
history.com
Located in New York County
  • Cable Television Services
  • Electronic Commerce
  • Satellite Equipment and System Dealers
  • Satellite Television Services

Hospice Of Orleans County Inc
Albion, New York 14411
1-585-589-5304
www.hospiceoforleans.org
Located in Orleans County
  • Electronic Commerce

Hudson Valley Furniture Service
Ossining, New York 10562
1-914-762-2833
www.myfurnitureguy.com/
Located in Westchester County
  • Electronic Commerce

Hudson Valley Seed Library LLC
Accord, New York 12404
1-845-204-8769
seedlibrary.org
Located in Ulster County
  • Electronic Commerce
  • Libraries

Husaon Mohawk Press
Latham, New York 12110
1-518-618-4651
www.hudsonmohawkpress.com
Located in Albany County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Infinibrand
Yorktown Heights, New York 10598
1-914-302-2185
infinibrand.com
Located in Westchester County
  • Electronic Commerce
  • Professional and Trade Associations

Infinite Shoes Downtown
New York, New York 10013
1-212-966-5210
www.infinityshoes.com
Located in New York County
  • Electronic Commerce
  • Shoe Stores

Influence Graphics
New York, New York 10001
1-212-354-1015
www.influencegraphics.com
Located in New York County
  • Commercial Printing
  • Computer Printers
  • Digital Printers
  • Electronic Commerce

Insurancetrak Services
Rochester, New York 14617
1-585-282-0934
www.insurancetrak.com
Located in Monroe County
  • Electronic Commerce
  • Liability and Malpractice Insurance

International Institute
New York, New York 10065
1-212-753-0846
www.isadoraduncan.net
Located in New York County
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

Jewelry Doctor Of New York
New York, New York 10036
1-646-560-0629
www.jewelryrepairnewyork.com
Located in New York County
  • Electronic Commerce
  • Jewelry Repair

Jewelry Nest
Woodmere, New York 11598
1-516-569-9267
www.jewelrynest.com
Located in Nassau County
  • Electronic Commerce
  • Jewelry Designers
  • Jewelry Wholesale and Manufacturers

Jildor Shoes
Great Neck, New York 11021
1-516-487-6464
www.jildorshoes.com
Located in Nassau County
  • Electronic Commerce
  • Shoe Stores

JMS & Eva Limited
New York, New York 10065
1-212-593-1113
jmseva.com
Located in New York County
  • Antique Dealers
  • Antiques
  • Electronic Commerce

Junior League Of Syracuse
Syracuse, New York 13202
1-315-423-9773
www.jlsyracuse.com
Located in Onondaga County
  • Civic Clubs and Organizations
  • Electronic Commerce
  • Youth Organizations, Centers and Clubs

K & L Soaring LLC
Cayuta, New York 14824
1-607-594-3329
klsoaring.com
Located in Schuyler County
  • Aircraft Modification and Overhaul
  • Electronic Commerce

Kashkaval Foods Limited
New York, New York 10019
1-212-581-8282
www.kashkavalfoods.com
Located in New York County
  • Cheese Shops
  • Electronic Commerce

Kenjo Watches
New York, New York 10019
1-212-402-7000
www.kenjo.net
Located in New York County
  • Electronic Commerce
  • Watches Retail

Kirna Zabete
New York, New York 10013
1-212-941-9656
www.kirnazabete.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Knapp Farm
Lowman, New York 14861
1-607-733-5269
knappfarm.net
Located in Chemung County
  • Electronic Commerce

Kyriba Corporation
New York, New York 10006
1-212-784-5581
www.kyriba.com
Located in New York County
  • Computer Software
  • Electronic Commerce

L-Tron Corporation
Victor, New York 14564
1-585-383-0050
l-tron.com
Located in Ontario County
  • Electronic Commerce

Label Shopper
Amenia, New York 12501
1-845-373-9066
labelshopper.com
Located in Dutchess County
  • Clothing Stores
  • Electronic Commerce

Lake George Arts Project
Lake George, New York 12845
1-518-668-2616
www.lakegeorgearts.org
Located in Warren County
  • Arts Organizations and Information
  • Electronic Commerce

Lemoyne College Bookstore
Syracuse, New York 13214
1-315-251-0300
lemoyne.edu
Located in Onondaga County
  • Bookstores
  • Electronic Commerce

Lens Land
New Hyde Park, New York 11040
1-516-775-2485
www.eyeglasses123.com
Located in Nassau County
  • Contact Lenses
  • Electronic Commerce
  • Optical Goods Retail

Life Science Pharmacy Inc
Harriman, New York 10926
1-845-781-7613
www.lifesciencepharmacy.com
Located in Orange County
  • Drug Stores and Pharmacies
  • Electronic Commerce

Little Bird Nail Salon
Hampton Bays, New York 11946
1-631-723-1118
www.littlebirdnails.com
Located in Suffolk County
  • Beauty Salons
  • Electronic Commerce
  • Manicures and Pedicures

Local Galaxy Web Development
New York, New York 10009
1-212-254-7358
localgalaxy.com
Located in New York County
  • Electronic Commerce
  • Web Site Design

Long Islands Seo
Centerport, New York 11721
1-631-807-5332
www.longislandsseo.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Advertising
  • Internet Service Providers

M1-5
New York, New York 10013
1-212-965-1701
www.m1-5.com
Located in New York County
  • Bars and Pubs
  • Electronic Commerce

Map-It Inc
New York, New York 10017
1-800-929-6163
www.mapitinc.com
Located in New York County
  • Electronic Commerce
  • Graphics Services
  • Internet Service Providers
  • Web Site Design

Mark Grimm Communications
Schenectady, New York 12303
1-518-356-4865
www.markgrimm.com
Located in Schenectady County
  • Electronic Commerce

Martial Vivot LLC
New York, New York 10019
1-212-956-2990
martialvivot.com
Located in New York County
  • Barbers
  • Beauty Salons
  • Electronic Commerce

Mary Learner Of Cedarhurst
Cedarhurst, New York 11516
1-516-569-3150
www.shopcedarhurst.com
Located in Nassau County
  • Bras and Girdles Retail
  • Clothing Stores
  • Electronic Commerce

Match Show Bulletin
Massapequa, New York 11758
1-516-541-3442
www.matchshowbulletin.com
Located in Nassau County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

Maternity Center Association
New York, New York 10016
1-212-369-8747
childbirthconnection.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Government Contractors

Medical Letter Inc
New Rochelle, New York 10801
1-914-576-3377
www.medicalletter.com
Located in Westchester County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors
  • Magazine and Journal Publishers

Mediterranean Roofing & DSGNS
Great Neck, New York 11021
1-516-605-1530
www.clayroofs.com
Located in Nassau County
  • Building Contractors
  • Electronic Commerce
  • Roofing Contractors

Memories Funeral Home
Rochester, New York 14621
1-585-544-4929
memoriesfuneralhome.com
Located in Monroe County
  • Cremation Services
  • Electronic Commerce
  • Funeral Homes and Directors
  • Funeral Services

Mibar Computer Service
New York, New York 10018
1-212-869-9350
www.mibar.net
Located in New York County
  • Electronic Commerce

Miles Car Rental New York
New York, New York 10001
1-347-630-0669
www.milescarrentalnewyork.com
Located in New York County
  • Auto Rental
  • Electronic Commerce

MLB Advanced Media LP
New York, New York 10011
1-212-485-3456
pressbox.mlb.com
Located in New York County
  • Electronic Commerce
  • Sports and Recreation Clubs and Organizations

Mobile Programming LLC
New York, New York 10006
1-212-688-6950
www.mobileprogramming.com
Located in New York County
  • Electronic Commerce

Montauk Friends of Erin
Montauk, New York 11954
1-631-668-1578
www.montaukfriendsoferin.com
Located in Suffolk County
  • Electronic Commerce

Myworldphone.com
New York, New York 10118
1-212-438-3210
myworldphone.com
Located in New York County
  • Cell Phone Services
  • Electronic Commerce

Newburgh Envelope Corporation
Newburgh, New York 12550
1-845-566-4211
www.newburghenvelope.biz
Located in Orange County
  • Commercial Printing
  • Electronic Commerce
  • Printing Services

News Department Bureau Offices
Canton, New York 13617
1-315-386-3571
watertowndailytimes.com
Located in Saint Lawrence County
  • Commercial Printing
  • Electronic Commerce
  • Newspaper Publishers

Niagra Tradition Home Brewing
Buffalo, New York 14217
1-716-877-8767
www.nthomebrew.com
Located in Erie County
  • Electronic Commerce
  • Winemaking Equipment and Supplies

Nyscate
Latham, New York 12110
1-518-786-3981
nyscate.org
Located in Albany County
  • Business Education
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

New York News
Recent news headlines
about the state of New York
from diverse news sources.
www.the-news.us/new-york.php
  • New York Capitol Building

Oakhurst Co
Levittown, New York 11756
1-516-731-5607
oakhurst-medicine.com
Located in Nassau County
  • Drug Stores and Pharmacies
  • Electronic Commerce

Oberoi Hotels & Resorts
New York, New York 10022
1-212-223-8500
oberoihotels.com
Located in New York County
  • Electronic Commerce

Oddcast Inc
New York, New York 10018
1-212-279-7053
oddcast.com
Located in New York County
  • Electronic Commerce
  • Web Site Design

Office Of Paul Sahre
New York, New York 10011
1-212-741-7739
paulsahre.com
Located in New York County
  • Electronic Commerce
  • Fashion Designers

Olde Bryan Inn
Saratoga Springs, New York 12866
1-518-587-4316
oldebryaninn.com
Located in Saratoga County
  • American Restaurants
  • Electronic Commerce
  • Restaurants

Ooyala Inc
New York, New York 10003
1-646-237-5848
ooyala.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers

Opt-Intelligence
New York, New York 10018
1-212-594-3862
opt-intelligence.com
Located in New York County
  • Builders and Contractors
  • Building and Home Construction
  • Building Contractors
  • Construction Companies
  • Electronic Commerce
  • Home Builders and Developers

Orbus Software
New York, New York 10022
1-212-931-8021
www.orbussoftware.com
Located in New York County
  • Computer and Equipment Dealers
  • Computer Printers
  • Electronic Commerce

Osteopathy New York PC
New York, New York 10003
1-212-226-6264
www.osteopathyny.com
Located in New York County
  • Electronic Commerce

Outdoor Bound Inc
New York, New York 10013
1-212-579-4568
discoveroutdoors.com
Located in New York County
  • Climbing, Hiking and Backpacking
  • Electronic Commerce
  • Outdoor Sports and Recreation
  • Wildlife Services

Oxford Seminars
New York, New York 10001
1-800-779-1779
www.oxfordseminars.com
Located in New York County
  • Business Education
  • Electronic Commerce
  • Schools

ozEworks, Inc
Brooklyn, New York 11209
1-718-336-4760
www.ozEworks.com
Located in Kings County
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Internet Services
  • Virtual Hosting Providers

Park Side Candy Co
Buffalo, New York 14219
1-716-824-5303
www.parksidecandy.com
Located in Erie County
  • Candy and Confectionery Wholesale and Manufacturers
  • Electronic Commerce

Parliament Tutors
White Plains, New York 10605
1-914-417-9202
www.parliamenttutors.com
Located in Westchester County
  • Colleges and Universities
  • Electronic Commerce
  • Test Preparation and Tutoring Services

Payvision
New York, New York 10013
1-917-237-0900
www.payvision.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers
  • Mail Order and Catalog Sales

Perfect Choice Trading INC
New York, New York 10013
1-212-475-2732
www.choiceofbeauty.com
Located in New York County
  • Electronic Commerce

Perfective Ceuticals LLC
Uniondale, New York 11553
1-646-257-2032
perfectiveceuticals.com
Located in Nassau County
  • Electronic Commerce

Pigeons In Combat
New York, New York 10010
1-212-677-6833
pigeonsincombat.com
Located in New York County
  • Electronic Commerce
  • Internet Service Providers

Pioneer Services
Evans Mills, New York 13637
1-315-629-1526
www.pioneermilitaryloans.com/fortdrum
Located in Jefferson County
  • Electronic Commerce
  • Mortgage and Loan Banks

Plainview Carpet Cleaning Professional
Plainview, New York 11803
1-516-252-1732
mrcarpetcleaningplainviewny.weebly.com
Located in Nassau County
  • Carpet, Rug and Upholstery Cleaning
  • Carpet, Rug and Upholstery Storage and Repair
  • Electronic Commerce

PRC Industries
Saint James, New York 11780
1-631-750-9600
www.prcind.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Products and Services

Profit Partner Solution
Depew, New York 14043
1-800-519-7800
www.profitpartnersolutions.com/
Located in Erie County
  • Electronic Commerce
  • Internet Marketing Services
  • Logos
  • Web Site Design

Publishers Weekly
New York, New York 10010
1-212-377-5500
publishersweekly.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers
  • Publishers

Raktrul Foundation
Red Hook, New York 12571
1-845-758-9392
raktrulfoundation.org
Located in Dutchess County
  • Electronic Commerce

Red Flower Retail
New York, New York 10012
1-212-966-5301
redflower.com
Located in New York County
  • Electronic Commerce

Riding Right Farm
Buskirk, New York 12028
1-518-677-5148
www.ridingfarm.com
  • Electronic Commerce

Ritz Tours & Travel Inc
New York, New York 10017
1-212-973-1998
ritztours.com
Located in New York County
  • Electronic Commerce

Roberts Eyecare Associate - Subadra Arunagirinatha Od
Vestal, New York 13850
1-607-722-3937
robertseyecare.net
Located in Broome County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

Roberts Eyecare Associate - Tammy Carlson Od
Vestal, New York 13850
1-607-722-3937
www.robertseyecare.net/
Located in Broome County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

Rochester Business Journal Inc
Rochester, New York 14604
1-585-546-3398
www.rbj.net
Located in Monroe County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers
  • Newspaper Publishers

Rochester Education Foundation
Rochester, New York 14614
1-585-271-5790
www.rochestereducation.org
Located in Monroe County
  • Electronic Commerce

Rochester Regional Community DSGN
Rochester, New York 14609
1-585-271-0520
www.rrcdc.org
Located in Monroe County
  • Counseling Services
  • Electronic Commerce
  • Social and Human Services Organizations
  • Social and Human Services

Routledge
New York, New York 10016
1-212-695-6599
www.routledge.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Publishers

RPNY Tennis
New York, New York 10022
1-212-980-1555
www.rpnytennis.com
Located in New York County
  • Electronic Commerce

Rye Eye Care - Steven S Bloom Od
Rye, New York 10580
1-914-967-1632
www.ryeeyecare.com
Located in Westchester County
  • Contact Lenses
  • Electronic Commerce
  • Optometrists

S&P Capital Iq Inc
New York, New York 10041
1-212-438-8710
capitaliq.com
Located in New York County
  • Electronic Commerce

Santelli Lumber Co
Palmyra, New York 14522
1-315-597-6191
www.santellilumber.com
Located in Wayne County
  • Building Materials and Supplies Dealers
  • Electronic Commerce
  • Lumber Dealers

Service Employees Intl Union
Buffalo, New York 14226
1-716-631-3929
www.seiu200united.org
Located in Erie County
  • Electronic Commerce
  • Labor Organizations

Service Now
New York, New York 10165
1-212-490-9633
www.service-now.com
Located in New York County
  • Computer Software
  • Electronic Commerce

Shawn L Watson Hemphil
Rochester, New York 14621
1-585-544-4931
memoriesfuneralhome.com
Located in Monroe County
  • Electronic Commerce
  • Funeral Homes and Directors

Shelters Of Saratoga Inc
Saratoga Springs, New York 12866
1-518-581-1097
www.sheltersofsaratoga.com
Located in Saratoga County
  • Electronic Commerce

Singer 22
Roslyn Heights, New York 11577
1-516-626-1600
singer22.com
Located in Nassau County
  • Clothing Stores
  • Electronic Commerce

Skyhorse Publishing Inc
New York, New York 10018
1-212-643-6816
www.skyhorsepublishing.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Sphatika International
New York, New York 10023
1-212-265-5885
www.sphatika.com
Located in New York County
  • Beauty and Day Spas
  • Beauty Salons
  • Electronic Commerce

Streetid
New York, New York 10004
1-646-783-7523
www.streetid.com
Located in New York County
  • Career and Vocational Counseling
  • Counseling Services
  • Electronic Commerce

Subscriber Hot Line
New York, New York 10018
1-212-333-4052
primarystages.org
Located in New York County
  • Electronic Commerce
  • Live Theater

Super Market Parts Replacement
Mountain Dale, New York 12763
1-800-767-9855
smpw.com
Located in Sullivan County
  • Electronic Commerce
  • Fruits and Vegetables
  • Grocery Stores and Supermarkets

Tateossian
New York, New York 10016
1-212-213-6119
www.tateossian.com
Located in New York County
  • Electronic Commerce

Teneues Publishing Co
New York, New York 10011
1-212-627-9511
teneues.com
Located in New York County
  • Book Publishers
  • Commercial Printing
  • Electronic Commerce

Teri Jon Inc
New York, New York 10018
1-212-302-2726
terijon.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce

Texas Monthly
New York, New York 10165
1-212-949-4292
www.texasmonthly.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

The Drawing Center
New York, New York 10013
1-212-966-2976
www.drawingcenter.org
Located in New York County
  • Business and Professional Associations and Organizations
  • Electronic Commerce
  • Government Contractors
  • Importers

The Gershwin Theatre
New York, New York 10019
1-212-586-6510
www.gershwintheatre.com
Located in New York County
  • Electronic Commerce

Torcomp Inc
Sanborn, New York 14132
1-716-731-9090
www.studica.com
Located in Niagara County
  • Computer Software
  • Electronic Commerce
  • Government Contractors

Two Little Hands Training Center
New York, New York 10032
1-917-627-3785
www.twolittlehandstc.com
Located in New York County
  • Electronic Commerce

Ukrainian Church Holy Family
Lindenhurst, New York 11757
1-631-225-1168
holyfamilyucc.com
Located in Suffolk County
  • Churches
  • Electronic Commerce

Unreal Web Marketing
Port Jefferson, New York 11777
1-631-828-5227
www.unrealstudio.com
Located in Suffolk County
  • Electronic Commerce
  • Internet Marketing Services
  • Web Site Developers

Viscusi Wholesale Grocers Inc
Schenectady, New York 12303
1-518-377-8269
www.casavisco.com
Located in Schenectady County
  • Electronic Commerce

Web Studios
New York, New York 10019
1-212-786-6026
www.webstudios.com
Located in New York County
  • Electronic Commerce
  • Information Technology Services
  • Internet Products and Services
  • Web Site Design

Westchester Magazine
Elmsford, New York 10523
1-914-345-0601
www.westchestermagazine.com
Located in Westchester County
  • Commercial Printing
  • Electronic Commerce
  • Magazine and Journal Publishers

WNET
New York, New York 10019
1-212-560-1313
wnet.org
Located in New York County
  • Electronic Commerce

WPIX
New York, New York 10017
1-212-210-2681
wpix.com
Located in New York County
  • Bed and Breakfasts
  • Electronic Commerce
  • Television Stations

You Are Beautiful People Inc
Warwick, New York 10990
1-845-986-5944
beautiful-people.us
Located in Orange County
  • Electronic Commerce
  • Youth Organizations, Centers and Clubs

YRB NYC
New York, New York 10013
1-212-219-8569
www.yellowratbastard.com
Located in New York County
  • Clothing Stores
  • Electronic Commerce
  • Sportswear Retail

Zeitgeist Films
New York, New York 10013
1-212-274-1989
zeitgeistfilms.com
Located in New York County
  • Commercial Printing
  • Electronic Commerce
  • Government Contractors
  • Photofinishing Retail

Electronic Commerce in Adjacent States

New York Directory and Map Pages


Related New York Page(s)

new-york map icon and sliced and diced green, red, and yellow peppers
New York Fruits & Vegetables
new-york map icon and two grocers working in a grocery store
New York Grocery Stores & Supermarkets

217 e-commerce service providers listed in New York.
Copyright © 2010- RegionalDirectory.us.  All rights reserved.
Click "☎ & 🔍" for mobile-friendly phone link & locator map pages.

New York Electronic Commerce